PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00006886001
Common NameGSBRNA2T00006886001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 366aa    MW: 39261.1 Da    PI: 9.0918
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00006886001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof117.74.6e-3793152362
               zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                          e+alkcprCds+ntkfCy+nnysl+qPr+fCk+CrryWt GGalr vPvGgg+r+nk+++
  GSBRNA2T00006886001  93 ETALKCPRCDSSNTKFCYFNNYSLTQPRHFCKSCRRYWTCGGALRSVPVGGGCRRNKRTK 152
                          6789*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3476145IPR003851Zinc finger, Dof-type
PfamPF027014.4E-3195150IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.13496150IPR003851Zinc finger, Dof-type
PROSITE patternPS01361098134IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MVFSSFPTYP DSSNWQQQHQ PITSTVGFTG NNNNISQQFL PHHPLPPQPQ QTPPPLHHNA  60
NGAGGGGSGG PSGLIRPGSM AERARLANIP LPETALKCPR CDSSNTKFCY FNNYSLTQPR  120
HFCKSCRRYW TCGGALRSVP VGGGCRRNKR TKNSGGGGGS SSSGNSKSQD STTSNDQYHH  180
RAMASNQMGP PSSSTSLSSL LSSYNAGLIP GHNQSNNVHG LGSSLTPLKL MTPLDFTDNF  240
TLPFDQWRFP ATHQQLPLLG GLDNSSSSGL YPFDHQNQTG MHQQNPKNTF YDLSSASSAM  300
VTATASQLAS VKMEDSNNQL NMSKQLFGNE QHLWNFHGAA RSTAATTCSW SDASNNFSSS  360
STSNI*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.145386e-67seed
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1896460.0AC189646.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrS009G14, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013681300.10.0PREDICTED: dof zinc finger protein DOF5.1-like
SwissprotQ9LZ561e-130DOF51_ARATH; Dof zinc finger protein DOF5.1
TrEMBLA0A078JV780.0A0A078JV78_BRANA; BnaCnng69430D protein
STRINGBra028872.1-P1e-150(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM115191732
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02460.11e-105Dof family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]